DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and R3hdml

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001102432.1 Gene:R3hdml / 366245 RGDID:1305296 Length:253 Species:Rattus norvegicus


Alignment Length:281 Identity:62/281 - (22%)
Similarity:95/281 - (33%) Gaps:94/281 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SILLLAGLLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKYYA-------SIP 60
            ||:.||||||.:...|......|.     .|.|               ||.|..|       .:|
  Rat     6 SIVGLAGLLLWMGHTVGALRMPNT-----TLVQ---------------GRPKNIAVWPLSGLGVP 50

  Fly    61 DTLKVR----KDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSF 121
            ...:.|    :|..|:|:....:.|         ...|.|..|..:.||.:||..|...|....:
  Rat    51 RHRRKRHISARDMNALLDYHNHIRA---------SVHPPASNMEYMVWDEQLARAAEAWATQCIW 106

  Fly   122 MHSECRSTLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTVQD-PQSFARRFDSKRDY 185
            .|...:             |:..||..||:..          ..|::|.| .:|::   :.||.|
  Rat   107 AHGPSQ-------------LTKYVGQNLSVHS----------GRYRSVVDLVKSWS---EEKRHY 145

  Fly   186 S-------------------VGHFSIIVNDRVSRVGCGFAVGSNCEKDGKV-GFCHFLTCHFDYT 230
            |                   ..|::.:|....||:||.....|:....|.. ....:|.|::   
  Rat   146 SFPAPKDCTPHCPWLCSGPVCSHYTQMVWASSSRLGCAIHTCSSINVWGSTWQQAVYLVCNY--- 207

  Fly   231 NVNGSYV----YKTGKATTGC 247
            .:.|:::    |||||..:.|
  Rat   208 AIKGNWIGEAPYKTGKPCSAC 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 38/186 (20%)
R3hdmlNP_001102432.1 SCP 65..207 CDD:294090 36/176 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344653
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.