DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and CG17575

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster


Alignment Length:303 Identity:82/303 - (27%)
Similarity:131/303 - (43%) Gaps:60/303 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLAGLLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKYYASIPDTLKVRKDT 69
            |||  ||:||...:..::||:  ..:|...:| |..|     ..:|..|...:  ||...||..|
  Fly     9 LLL--LLMLLGQQLQAFDYCD--PTLCPGPER-HIAC-----NNFGALADICS--PDAHIVRITT 61

  Fly    70 ------LAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRS 128
                  |..||.:||.:|.|:|     ..|..|.||..||||.|||..|..:....:.::..||:
  Fly    62 ARRTMILNELNEYRDRIARGDL-----MGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRN 121

  Fly   129 TLRFPLAGEVLA--------LSP-------------PVGHRLSLTELLRMVFAHIFDEYK--TVQ 170
            :.:|....:|:|        |.|             ||.:... .|:::.....:|.|||  :::
  Fly   122 SEQFRNVAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTE-DEVIKATLEQMFAEYKECSMR 185

  Fly   171 DPQSFA----RRFDSKRDYSVGHFSIIVNDRVSRVGCGF---AVGSNCEKDGKVGFCH-FLTCHF 227
            |..:|:    |....:....:.:|:.:|.|..:.||||.   ...:..|....:...| ::||:|
  Fly   186 DIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNF 250

  Fly   228 DYTNVNGSYVYKTG-KATTGCNDWKTIASIKYSNLCENTGEIF 269
            ..||...:.||::| :..|.|...:....|   ||| :..||:
  Fly   251 VRTNDVNAPVYQSGDRPATECRSGRNPVFI---NLC-SVNEIY 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 50/198 (25%)
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 48/191 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440662
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.