DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and CG9400

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster


Alignment Length:280 Identity:83/280 - (29%)
Similarity:125/280 - (44%) Gaps:49/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAGLLLLL------LPMVAGYNYC-------NNRTHVCDLAQRKHFMC-RLGELKPYGGRAKYYA 57
            |||...|:      .|..:| .||       .|.||   |....|..| ..|...|..|..    
  Fly    29 LAGAQTLIETITTTTPASSG-GYCAAALCELYNGTH---LVHVPHTACGNNGSFSPACGPE---- 85

  Fly    58 SIPDTLKV----RKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAAT 118
              |..|::    |:..|.:.|..|..:|.|.||     .:.||..|..|:||:||..||..||..
  Fly    86 --PKLLEMSERRRQLLLDMHNLARSKIASGNLD-----GYRSAAHMPLLRWDTELEQMAALHAKR 143

  Fly   119 VSFMHSECRSTLRFPLAGEVLALSPPVGHRLSLTEL---LRMVFAHIFDEYKTVQDP-QSFARRF 179
            ..|.|.:||:|.||..:|:      .:|:.....|.   .|.:.:.:.:.::..||. |||..|:
  Fly   144 CQFAHDKCRNTPRFKFSGQ------NIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRY 202

  Fly   180 -DSKRDYSVGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCHFLTCHFDYTNVNGSYVYKTGKA 243
             ...:...:|||:::|:|||:||||   .|....:.....|...|||::||.|:....:|::|.|
  Fly   203 HPHPQGKKIGHFTLLVSDRVNRVGC---AGVRFLEPKSNRFQFMLTCNYDYNNIFNEPIYQSGPA 264

  Fly   244 TTGCNDWKTIASIKYSNLCE 263
            .:.|...:  .|.|:.:||:
  Fly   265 GSKCPQHR--ISEKFPSLCD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 53/166 (32%)
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 53/166 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440502
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
54.950

Return to query results.
Submit another query.