DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and CG31296

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster


Alignment Length:198 Identity:43/198 - (21%)
Similarity:72/198 - (36%) Gaps:35/198 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKYYASIPDTLKVRKDTLAVLNTFRDMLAGGELDT 87
            ||......|:...:...||      |...|....::..:.|      |...|.||:..|.|:   
  Fly    30 YCGTNNLACNNPSKFSVMC------PPNARTLSMSTYRNLL------LIAFNEFRNYTASGK--- 79

  Fly    88 AENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLRFPLAGEVLALSPPVGHRLSLT 152
             :.....:|.||..|.:..||..:||....|.| .|..|.::..|...|..:..:..:|:.....
  Fly    80 -QKYLKAAAARMSRLSYSMELEDLARLAVITCS-THKFCLNSQEFYYVGTNIGSTHYLGNLNDYE 142

  Fly   153 EL---LRMV-----FAHIFDEYKTVQDPQSFARRFDSKRDYSVGHFSIIVNDRVSRVGCG---FA 206
            :|   ||::     :|...:....|..|.:..:.       .:....:::.||.:.|||.   |.
  Fly   143 DLELMLRIIQHWTRYADYVNIKMGVYMPTTLGKS-------GIAKALLLMADRNTHVGCSAMRFT 200

  Fly   207 VGS 209
            |.|
  Fly   201 VHS 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 35/155 (23%)
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 36/161 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.