DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and CG32679

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster


Alignment Length:273 Identity:75/273 - (27%)
Similarity:123/273 - (45%) Gaps:41/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLAGLLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKYY---ASIPDTLKVR 66
            :.|..|:|::.......|||:  ..:|  ...:|..|:.......|...::.   |.||..|::.
  Fly     8 IFLLYLVLIIFTFTFAQNYCD--PELC--PSGRHVACQNSGRFVSGCSGEFVQVDAHIPLILQLH 68

  Fly    67 KDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLR 131
                   |..|:::|||.:     ..||||.:|..:.||:.||.:|..:|......|.|||:|..
  Fly    69 -------NERRNLIAGGGV-----SGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNT 121

  Fly   132 FPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEYK--TVQDPQSFARRFDSKRDYSVGHFSIIV 194
            :..||:.|::.  ....:.:...||...|..|||.:  |..|.:.:..|...    ::|||:.:|
  Fly   122 YRYAGQNLSIL--FTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGP----AIGHFTTMV 180

  Fly   195 NDRVSRVGCG---FAVGSNCEKDGKVGFCHFLTCHFDYTNVNGSYVYKTGKATTGCNDWKTIASI 256
            |:|.:||||.   |...:|.:       ...|.|::..|||..:.||:.|.|.:.|.   |..:.
  Fly   181 NERNNRVGCAIARFTDANNVQ-------ATLLACNYAVTNVVNNPVYRAGTAASECT---TGRNS 235

  Fly   257 KYSNLCENTGEIF 269
            .|.||| :..|::
  Fly   236 NYPNLC-SPNEVY 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 47/166 (28%)
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 48/171 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440620
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
65.850

Return to query results.
Submit another query.