powered by:
Protein Alignment CG43775 and CG32313
DIOPT Version :9
Sequence 1: | NP_726425.3 |
Gene: | CG43775 / 37863 |
FlyBaseID: | FBgn0264297 |
Length: | 272 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001261262.1 |
Gene: | CG32313 / 317973 |
FlyBaseID: | FBgn0052313 |
Length: | 182 |
Species: | Drosophila melanogaster |
Alignment Length: | 65 |
Identity: | 16/65 - (24%) |
Similarity: | 23/65 - (35%) |
Gaps: | 10/65 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 PMVAGYNYCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKYYASIPDTLKVRKDTLAVLNTFRDML 80
|||.....|...:...|...|...:.....|: ..||:.|.:.| .|.|:..||:.|
Fly 42 PMVLDEELCTECSEYADEIVRNEGVYTENYLE------YLYATDPISAK----HLQVVCVFREAL 96
Fly 81 80
Fly 97 96
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG43775 | NP_726425.3 |
SCP_euk |
66..228 |
CDD:240180 |
5/15 (33%) |
CG32313 | NP_001261262.1 |
SCP |
27..153 |
CDD:294090 |
16/65 (25%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45455180 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10334 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.940 |
|
Return to query results.
Submit another query.