DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and Crispld1

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001128435.1 Gene:Crispld1 / 316482 RGDID:1564813 Length:500 Species:Rattus norvegicus


Alignment Length:220 Identity:46/220 - (20%)
Similarity:71/220 - (32%) Gaps:92/220 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLRFPLAGEVLALSPPVGHRLSLTEL 154
            ::.:|:|..|..:.||.||...|.:.|.|..:.|..             .:|.|.:|..|.    
  Rat    74 SQVYPAASNMEYMTWDVELERSAESWAETCLWEHGP-------------TSLLPSIGQNLG---- 121

  Fly   155 LRMVFAHIFDEYKTVQDPQSFARR--FDSKRDYS-------------------VGHFSIIVNDRV 198
                 || :..|:    |.:|..:  :|..||:|                   ..|::.:|....
  Rat   122 -----AH-WGRYR----PPTFHVQAWYDEVRDFSYPYEHECDPYCPFRCSGPVCTHYTQVVWATS 176

  Fly   199 SRVGCGFAVGSNCEKDGKVGFCH-------------FLTCHFD-YTNVNGSYVYKTGKATT---- 245
            ||:||.            :..||             :|.|::. ..|..|...||.||..:    
  Rat   177 SRIGCA------------INLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHGKPCSACPP 229

  Fly   246 ----GCNDWKTIASIKYSNLCENTG 266
                ||.:          |||...|
  Rat   230 SFGGGCRE----------NLCYKEG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 34/171 (20%)
Crispld1NP_001128435.1 SCP_euk 63..207 CDD:240180 34/171 (20%)
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344632
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.