DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and Pi15

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001100387.1 Gene:Pi15 / 301489 RGDID:1309577 Length:258 Species:Rattus norvegicus


Alignment Length:201 Identity:52/201 - (25%)
Similarity:79/201 - (39%) Gaps:30/201 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RAKYYASIPDTLKVRKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHA 116
            |.|.|.|       :.|.:|:|: :.:.:.|        |.||.|..|..:.||..||..|...|
  Rat    57 RRKRYIS-------QNDMIAILD-YHNQVRG--------KVFPPAANMEYMVWDENLAKSAEAWA 105

  Fly   117 ATVSFMHSECRSTLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFD---EYKTVQDPQSFARR 178
            ||..:.|.. ...|||  .|:  .||...|...|:.:|::..:..:.|   .|....:|:...|.
  Rat   106 ATCIWDHGP-SYLLRF--LGQ--NLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRC 165

  Fly   179 FDSKRDYSVGHFSIIVNDRVSRVGCGFAVGSNCEKDGKV-GFCHFLTCHF-DYTNVNGSYVYKTG 241
            |..    ...|::.:|....:|:||......|....|.| ....:|.|:: ...|..|...||.|
  Rat   166 FGP----MCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVG 226

  Fly   242 KATTGC 247
            ...:.|
  Rat   227 VPCSSC 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 42/166 (25%)
Pi15NP_001100387.1 SCP_euk 69..212 CDD:240180 41/160 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344674
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.