DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and CG30486

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster


Alignment Length:274 Identity:66/274 - (24%)
Similarity:109/274 - (39%) Gaps:28/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILLLAGLLLLLLPMVA-GYNYCNNRTHVCDLAQRKHFMCR-LGELKPYGGRAKYYASIPDTLKVR 66
            :.||:.|:::|:...| ..:|||.  .:| |.:..|..|| .|:.....|........|  :.:|
  Fly     2 LYLLSVLIIVLISQEALSTDYCNK--DLC-LPEITHIACRNYGDFDESCGSEAIIMKFP--MHMR 61

  Fly    67 KDTLAVLNTFRDMLAGGELDTAENKTFP---SAKRMRALQWDSELAYMARTHAATVSFMHSECRS 128
            ...|||||.||:.:|.|:        :|   .|.||..|:|..|||.:|:.......::...|.:
  Fly    62 AHLLAVLNDFRNTVAKGQ--------YPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSN 118

  Fly   129 TLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTVQDPQSFARRFDSKRDYSVGHFSII 193
            |..|.....:...:..:........:|..|.....|:.|........|.: .:|.....|:|:.:
  Fly   119 TDEFSYVSYIYGSTKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEK-PAKDGQCRGYFTQL 182

  Fly   194 VNDRVSRVGCGFAVGSNCEKDGKVG--FCHFLTCHFDYTNVNGSYVYKTGKATTGCNDWKTIASI 256
            |.|..:.|||...:     :.|:..  :.:.:.|||....:....||: ..|..|...:....||
  Fly   183 VQDLAAHVGCAMML-----RKGQTSGLYQYGVLCHFSRGKIANELVYR-ASAHPGSRCYAGTHSI 241

  Fly   257 KYSNLCENTGEIFP 270
             |..||.....:.|
  Fly   242 -YEGLCSPEEHVNP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 39/166 (23%)
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 39/166 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440704
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.