DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and Crisp2

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001191000.1 Gene:Crisp2 / 22024 MGIID:98815 Length:243 Species:Mus musculus


Alignment Length:174 Identity:36/174 - (20%)
Similarity:61/174 - (35%) Gaps:32/174 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 PSAKRMRALQWDSELAYMARTHAATVSFMHS---ECRSTLRFPLAGEVLALSPPVGHRLSLTELL 155
            |:...:..::|..:....|:..|......||   :.:..:|   .||.|.:|..       ..|.
Mouse    54 PTGSDILKMEWSIQATTNAQKWANKCILEHSSKDDRKINIR---CGENLYMSTD-------PTLW 108

  Fly   156 RMVFAHIFDEYKTVQDPQSFARRFDSKRDYSVGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFC 220
            ..|....::|      .:.|.....:|.:.:|||::.:|.....::|||.|...|.:.......|
Mouse   109 STVIQSWYNE------NEDFVYGVGAKPNSAVGHYTQLVWYSSFKIGCGIAYCPNQDNLKYFYVC 167

  Fly   221 HFLTCHFDYTNVNGSYVYKTGKATTGCNDWKTIASIKYSNLCEN 264
            |:  |......:..|..|:.|.....|           .|.|||
Mouse   168 HY--CPMGNNVMKKSTPYQQGTPCASC-----------PNNCEN 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 28/136 (21%)
Crisp2NP_001191000.1 SCP_CRISP 36..171 CDD:240183 27/134 (20%)
Crisp 189..243 CDD:285731 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841361
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.