DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and scl-21

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_507793.1 Gene:scl-21 / 189870 WormBaseID:WBGene00012816 Length:198 Species:Caenorhabditis elegans


Alignment Length:201 Identity:51/201 - (25%)
Similarity:85/201 - (42%) Gaps:38/201 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 AKYYASIPDTLKVRKDTLAVLNTFRDMLAGG--ELDTAENKTFPSAKRMRALQWDSELAYMARTH 115
            |::.||      .:|:.:..:|..|.::|..  .||:.:.:|.|.|..|..:.|:|.||..|:..
 Worm    16 AQFSAS------AQKEIVTYINDLRSLVASRRFHLDSRDVETLPPASDMLKMTWNSTLAVAAQKL 74

  Fly   116 AATVSFMHSECRSTLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTVQD--PQSFARR 178
            |.| .|:..|              :.||.:..:       |:|.|::....|....  ..|..:.
 Worm    75 AKT-CFIAVE--------------SSSPGIADK-------RIVAANVVTVAKNALGHWKHSLNKE 117

  Fly   179 FDSKRDYSVGHFSI-IVNDRVSRVGCGFAVGSNCEKDGKVGFCHFLTCHFDYT-NVNGSYVYKTG 241
            ::.| .|:..:..| ::..:.|.|||||   |.||.|.:....:.:.|.|:.. .:....|||.|
 Worm   118 WNLK-SYNSNYIGIQLIWAKSSSVGCGF---SPCEIDSQGRRWYKVVCSFEKKGGITREPVYKKG 178

  Fly   242 KATTGC 247
            ||...|
 Worm   179 KACEAC 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 40/166 (24%)
scl-21NP_507793.1 CAP_euk 23..163 CDD:349399 40/165 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.