DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and scl-18

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_502228.2 Gene:scl-18 / 188436 WormBaseID:WBGene00011724 Length:225 Species:Caenorhabditis elegans


Alignment Length:225 Identity:48/225 - (21%)
Similarity:74/225 - (32%) Gaps:62/225 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 KVRKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRS 128
            |.::|.|...|..|..||.|...|..:....:...::...|::.|...|.:.|......||    
 Worm    36 KGQQDVLDHHNNIRSQLAFGNFVTKRHTKRAAGSNIKKFVWNATLERSAYSFAQKNPSQHS---- 96

  Fly   129 TLRFPLAGEVLALSPPVGHRLSLTELLRMVFAH------IFDEYKTVQDPQSFARRFDSK----- 182
                        ..|.:|..|         |.|      .|::|..:. ..|:.:.|..|     
 Worm    97 ------------FIPDIGENL---------FWHWSTRPGDFNKYGPMA-ALSWIKEFREKFWDSN 139

  Fly   183 ---RDY---SVGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVG-----FCHFLTCHF----DYTNV 232
               .|.   .|||.:.:|.....::||  ||....|...:.|     .|  :.||:    :|.| 
 Worm   140 ILTNDLFGSGVGHATQMVWADTYQMGC--AVSHFKEIHKRTGRPITKIC--VVCHYWPKGNYLN- 199

  Fly   233 NGSYVYKTGKATTGCNDWKTIASIKYSNLC 262
              ..:|..|...:.|...|   ..|.:.||
 Worm   200 --EPIYLEGPPCSKCESKK---CDKRTGLC 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 38/187 (20%)
scl-18NP_502228.2 SCP 37..193 CDD:214553 38/185 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.