DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and C07A4.3

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_509707.2 Gene:C07A4.3 / 182352 WormBaseID:WBGene00007398 Length:207 Species:Caenorhabditis elegans


Alignment Length:168 Identity:35/168 - (20%)
Similarity:65/168 - (38%) Gaps:49/168 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 ALQWDSELAYMARTHAATVSFMHSECR---------------STLRFPLAGEVLALSPPVGHRLS 150
            |:..||.|..:|:..:..::| |.:|.               ::.:||        ||    :..
 Worm    63 AVTVDSNLTNLAQKWSDEMAF-HKKCLVHEQPSKYGENLTSFASSKFP--------SP----KTC 114

  Fly   151 LTELLRMVFAHIFDEYKTVQDPQSFARRFDSKRDYSVGHFSIIVNDRVSRVGCGFAVGSNCEKDG 215
            ...|:...:...:....|..:|.|:::         ||||:.::.....::|.|.:|.    |.|
 Worm   115 AAALIHGFYTEGYGFNYTRFNPGSWSK---------VGHFTQLLWKNSRKIGVGVSVA----KRG 166

  Fly   216 KVGFCHFLTC-HFDYT-NVNGSYVY----KTGKATTGC 247
            .:  .|...| .:|.. |:..|..|    :..|:|:||
 Worm   167 TM--YHVYVCIKYDPPGNMQTSEAYMDNVRAPKSTSGC 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 27/142 (19%)
C07A4.3NP_509707.2 CAP_GAPR1-like 43..183 CDD:349401 28/147 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.