DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and C07A4.2

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_509706.2 Gene:C07A4.2 / 182351 WormBaseID:WBGene00007397 Length:417 Species:Caenorhabditis elegans


Alignment Length:195 Identity:36/195 - (18%)
Similarity:64/195 - (32%) Gaps:74/195 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 MCRLGELKPY-GGRAKYYASIP---DTLKVRKDTLAVLNTFRD------MLAGGELDTAENKTFP 94
            :..:|.:|.| ..::|.....|   |..|:::..::..|.:|.      :::...||:       
 Worm   223 LSNIGAIKSYLFSKSKVDKQDPARYDIPKLKEWLVSYHNVYRSKHGAPALISDSVLDS------- 280

  Fly    95 SAKRMRALQWDSELAY--------MARTHAATVSFM---HSECRSTL------RFPLAGEVLALS 142
                 |..:|..||||        ..||:...:.|.   |.....||      .|.|.|      
 Worm   281 -----RGKRWADELAYHKGCLVHEQPRTYGENLFFFGARHLPSPQTLAAAVIQSFYLEG------ 334

  Fly   143 PPVGHRLSLTELLRMVFAHIFDEYKTVQDPQSFARRFDSKRDYSVGHFSIIVNDRVSRVGCGFAV 207
              :|:..|...                  |.||         :..|||:.::.....::|.|.::
 Worm   335 --IGYNYSSWR------------------PMSF---------FKTGHFTQLIWKNSRKIGVGVSI 370

  Fly   208  207
             Worm   371  370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 29/165 (18%)
C07A4.2NP_509706.2 CAP_GAPR1-like 251..402 CDD:349401 30/167 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.