DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and vap-2

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001300377.1 Gene:vap-2 / 181273 WormBaseID:WBGene00011462 Length:507 Species:Caenorhabditis elegans


Alignment Length:211 Identity:54/211 - (25%)
Similarity:85/211 - (40%) Gaps:37/211 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RKDTLAVLNTFRDMLAGG-ELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRST 129
            |..||...|.:|..||.| |.:...|.:.|.|.:|..:::|..|...|:..|....|.||   :.
 Worm   316 RNFTLEQHNFYRSRLAKGFEWNGETNTSQPKASQMIKMEYDCMLERFAQNWANNCVFAHS---AH 377

  Fly   130 LRFPLAGEVL---ALSPPVGHRLSLTELLRMVFAHIFDEYKTVQDPQSFARRFDSKRDYSVGHFS 191
            ...|..|:.|   :.|.|....|..|.:.:  :....:|:.|..|.......:|.| ..::||::
 Worm   378 YERPNQGQNLYMSSFSNPDPRSLIHTAVEK--WWQELEEFGTPIDNVLTPELWDLK-GKAIGHYT 439

  Fly   192 IIVNDRVSRVGCGFAVGSNCEKDGKVGFCHFLTCHFDYT-NVNGSYVYKTGKAT---------TG 246
            .:..||..|:|||.|   ||.|      ..::.||:... |...:.:|:.|...         |.
 Worm   440 QMAWDRTYRLGCGIA---NCPK------MSYVVCHYGPAGNRKNNKIYEIGDPCEVDDDCPIGTD 495

  Fly   247 CNDWKTIASIKYSNLC 262
            |.        |.::||
 Worm   496 CE--------KTTSLC 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 46/165 (28%)
vap-2NP_001300377.1 SCP 104..253 CDD:214553
SCP 315..468 CDD:214553 46/166 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.