DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and scl-3

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_502504.1 Gene:scl-3 / 178252 WormBaseID:WBGene00009896 Length:211 Species:Caenorhabditis elegans


Alignment Length:207 Identity:45/207 - (21%)
Similarity:76/207 - (36%) Gaps:47/207 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 NTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECR----------S 128
            |..|..:|.|.. .|:..|..:...:..::||:.||..|:|.|.|....||...          |
 Worm    33 NKLRTSIAKGTY-VAKGTTKAAGSNLLKMKWDTTLATAAQTFANTCPRGHSNAAGVGENLYWRWS 96

  Fly   129 TLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEY--KTVQDPQSFARRFDSKRDYSVGHFS 191
            :|  |.:|..:     .|...|      :.:...|.:|  .|....|:.|       :..:||.:
 Worm    97 SL--PFSGMDI-----YGGAAS------VAWEQEFQQYGWTTNTFTQALA-------NTGIGHAT 141

  Fly   192 IIVNDRVSRVGCGFAVGSNCEKDGKVGFCH--FLTCHFDYTNVNGSY----VYKTGKATTGCNDW 250
            .:.......:|||.   .||..|.::...:  .:.|.:   ...|:|    :||:|...:.|...
 Worm   142 QMAWANTGLIGCGV---KNCGPDPELNNYNRAVVVCQY---KAQGNYLGQDIYKSGTTCSACPTG 200

  Fly   251 KTIASIKYSNLC 262
            .|..:.  :.||
 Worm   201 TTCEAA--TGLC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 36/167 (22%)
scl-3NP_502504.1 SCP 23..176 CDD:214553 36/166 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.