Sequence 1: | NP_726425.3 | Gene: | CG43775 / 37863 | FlyBaseID: | FBgn0264297 | Length: | 272 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_502503.1 | Gene: | scl-2 / 178251 | WormBaseID: | WBGene00009895 | Length: | 207 | Species: | Caenorhabditis elegans |
Alignment Length: | 200 | Identity: | 41/200 - (20%) |
---|---|---|---|
Similarity: | 72/200 - (36%) | Gaps: | 63/200 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 74 NTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLRFPLAGEV 138
Fly 139 LALSPPVGHRL-------SLTELLRMVFAHIFDEYKTVQDPQSFARRFDSKRDY----------- 185
Fly 186 ---SVGHFSIIVNDRVSRVGCGFAVGSNCEKD----GKVGFCHFLTCHF-DYTNVNGSYVYKTGK 242
Fly 243 ATTGC 247 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG43775 | NP_726425.3 | SCP_euk | 66..228 | CDD:240180 | 35/179 (20%) |
scl-2 | NP_502503.1 | SCP | 21..174 | CDD:214553 | 35/179 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10334 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X35 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 4.020 |