DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and lon-1

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_498166.1 Gene:lon-1 / 175753 WormBaseID:WBGene00003055 Length:312 Species:Caenorhabditis elegans


Alignment Length:297 Identity:66/297 - (22%)
Similarity:101/297 - (34%) Gaps:85/297 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLAGLLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGE-LKPYGGRAKYYASIPDTLKVRKDT 69
            ||..|:.||.|:...||..:.            |:  .|| :..:.|.......:|.|.:|:::.
 Worm     4 LLTALIALLAPISVAYNVPHG------------FL--TGEAVTSHSGPNDLDGELPATDEVKREK 54

  Fly    70 LAVLNTFRDMLAGGELDTAEN----------------KTFPSAKRMRALQWDSELAYMARTHAAT 118
            .............|.|..:|:                :....|..|..|.|..|||..|:.||.|
 Worm    55 RGYFFPSHFQSDSGLLSRSEHPNEYLKKWITHEHNRYRRMVPASDMNMLYWSDELAASAQRHADT 119

  Fly   119 VSFMHSECRSTLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDE----YKTVQDPQSFARRF 179
            ..|.||..|..:     ||.:..:|               :::..|.    :..|.:|     |.
 Worm   120 CDFRHSRGRINV-----GENIWAAP---------------YSNYSDAISIWFNEVHNP-----RC 159

  Fly   180 DSKRDYS--VGHFSIIVNDRVSRVGCGFAVGSNC-EKDGKVGFCH--FLTCHFDYTNVNGSYVYK 239
            .....|.  .||:..:|..:.:.|||||   |.| :..|..|..|  ...||:   |..|:.|:.
 Worm   160 GCNHAYKHCCGHYVQVVWAKTNLVGCGF---SRCRDVQGVWGRGHRNVFVCHY---NPQGNTVFV 218

  Fly   240 TGKA----------TTG----CNDWKTIASIKYSNLC 262
            |.:.          .:|    |::....|...|..||
 Worm   219 TARGQLYAMPAFTWASGDNGKCSNCPANAPACYQGLC 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 41/186 (22%)
lon-1NP_498166.1 SCP 81..211 CDD:214553 38/160 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.