DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and Crispld2

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_612527.2 Gene:Crispld2 / 171547 RGDID:620860 Length:497 Species:Rattus norvegicus


Alignment Length:294 Identity:46/294 - (15%)
Similarity:85/294 - (28%) Gaps:135/294 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CRLGELKPYG------GRAKYYASIPDTLKV------------------------RKDTLAVLNT 75
            |.|..:.|.|      |...::  :|:|:.:                        |::.|.:.|.
  Rat     3 CLLNNMVPVGLALLVCGVQAFF--LPNTMSLERLLSKYQHTEPHSRVRRAIPMSDRQEILMLHNK 65

  Fly    76 FRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLRFPLAGEVLA 140
            .|            .:.:|.|..|..:.||.||...|...|....:.|...             :
  Rat    66 LR------------GQVYPPASNMEYMTWDEELERSAAAWAQRCLWEHGPA-------------S 105

  Fly   141 LSPPVGHRLSLTELLRMVFAHIFDEYKTVQDP----QSFARRFDSKRDYS--------------- 186
            |...:|..|::             .:...:.|    ||:   :|..:||:               
  Rat   106 LLVSIGQNLAV-------------HWGRYRSPGFHVQSW---YDEVKDYTYPYPHECNPWCPERC 154

  Fly   187 ----VGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCH-------------FLTCHFDYTNVNG 234
                ..|::.:|....:::||.            |..|.             :|.|::   :..|
  Rat   155 SGAMCTHYTQMVWATTNKIGCA------------VHTCRSMSVWGDIWENAVYLVCNY---SPKG 204

  Fly   235 SYV----YKTGKATTGCNDWKTIASIKYSNLCEN 264
            :::    ||.|:..:.|..       .|...|.|
  Rat   205 NWIGEAPYKHGRPCSECPS-------SYGGGCRN 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 31/197 (16%)
Crispld2NP_612527.2 SCP_euk 56..201 CDD:240180 31/200 (16%)
LCCL 286..370 CDD:128866
LCCL 389..487 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344695
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.