DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and CRISP1

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001122.2 Gene:CRISP1 / 167 HGNCID:304 Length:249 Species:Homo sapiens


Alignment Length:283 Identity:57/283 - (20%)
Similarity:90/283 - (31%) Gaps:97/283 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KHFM------CRLG--ELKPYGGRAKYYASIPDTLKVRKDTLAVLNTFRDMLAGGELDTAENKTF 93
            ||.:      |.|.  .:|....|.::...:.|...|:::.:.:.|..|            .:..
Human     4 KHLLFLVAAACLLPMLSMKKKSARDQFNKLVTDLPNVQEEIVNIHNALR------------RRVV 56

  Fly    94 PSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLRFPL--------AGEVLALSPPVGHRLS 150
            |.|..|..:.|..|.|..||       .....|..|...||        .||.:.::   .:.:|
Human    57 PPASNMLKMSWSEEAAQNAR-------IFSKYCDMTESNPLERRLPNTFCGENMHMT---SYPVS 111

  Fly   151 LTELLRM------VFAHIFDEYKTVQDPQSFARRFDSKRDYSVGHFSIIVNDRVSRVGCGFAVGS 209
            .:.::.:      .|.|  .|:.|..|            |.:..|::.||......:||..|   
Human   112 WSSVIGVWYSESTSFKH--GEWTTTDD------------DITTDHYTQIVWATSYLIGCAIA--- 159

  Fly   210 NCEKDGKVGF---CHFLTCHFDYTNVNGSYVYKTG------------KATT-------------- 245
            :|.:.|...:   ||:  ||........:..||||            |..|              
Human   160 SCRQQGSPRYLYVCHY--CHEGNDPETKNEPYKTGVPCEACPSNCEDKLCTNPCIYYDEYFDCDI 222

  Fly   246 -----GCNDWKTIASIKYSNLCE 263
                 |||...||...|.:.||:
Human   223 QVHYLGCNHSTTILFCKATCLCD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 35/178 (20%)
CRISP1NP_001122.2 SCP_CRISP 39..177 CDD:240183 34/178 (19%)
Crisp 195..249 CDD:285731 10/51 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151263
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.