DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and CG43776

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster


Alignment Length:263 Identity:137/263 - (52%)
Similarity:184/263 - (69%) Gaps:2/263 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKYYASIPDTLKVRKDTLAVLN 74
            ::|::..|..||||||||||.|.|...:||||||.::...|| .:|:|.:||..|:|.:.|.::|
  Fly     9 VILMISTMTYGYNYCNNRTHRCILLNTQHFMCRLDKIPSLGG-TRYHAIVPDIPKLRTEILRIIN 72

  Fly    75 TFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLRFPLAGEVL 139
            .||:..|.|...|:||:||..|||||.:.||||||||||:||:||||.|::||||:|||..||.|
  Fly    73 NFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFPRVGECL 137

  Fly   140 ALSPPVGHRLSLTELLRMVFAHIFDEYKTVQDPQSFARRFDSKRDYSVGHFSIIVNDRVSRVGCG 204
            |:..| .::.::.|.|:.:|..:|||:..:|||:...:.|...|||...||:|||:|||||||||
  Fly   138 AMMVP-KYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDYVSSHFTIIVSDRVSRVGCG 201

  Fly   205 FAVGSNCEKDGKVGFCHFLTCHFDYTNVNGSYVYKTGKATTGCNDWKTIASIKYSNLCENTGEIF 269
            .|||:||.:.....|||||||:|||.|||||||||.||..:.|:||.|..|.:::|||.|.|.:.
  Fly   202 VAVGTNCRQGSSSNFCHFLTCYFDYDNVNGSYVYKAGKPASSCSDWGTTKSKEFANLCYNNGNLI 266

  Fly   270 PLE 272
            |.:
  Fly   267 PAD 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 85/161 (53%)
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 85/161 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440499
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26204
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0016576
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
87.860

Return to query results.
Submit another query.