DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and R3HDML

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_848586.1 Gene:R3HDML / 140902 HGNCID:16249 Length:253 Species:Homo sapiens


Alignment Length:280 Identity:60/280 - (21%)
Similarity:100/280 - (35%) Gaps:88/280 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSILLLAGLLL--------LLLPMVAGYNYCNNRTHVCDLAQRKHFMCRL--G-ELKPYGGRAK 54
            :.|.:.|||||.        |::|         |.|..  .||.:....||  | |:..|  |.|
Human     4 LPSTVGLAGLLFWAGQAVNALIMP---------NATPA--PAQPESTAMRLLSGLEVPRY--RRK 55

  Fly    55 YYASIPDTLKVRKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATV 119
            .:.|:       :|..|:|:....:.|         ..:|.|..|..:.||..||..|...|...
Human    56 RHISV-------RDMNALLDYHNHIRA---------SVYPPAANMEYMVWDKRLARAAEAWATQC 104

  Fly   120 SFMHSECRSTLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTVQD------PQSFARR 178
            .:.|...: .:|:            ||..||:..          .:|::|.|      .:.:...
Human   105 IWAHGPSQ-LMRY------------VGQNLSIHS----------GQYRSVVDLMKSWSEEKWHYL 146

  Fly   179 FDSKRDY-----------SVGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGF-CHFLTCHFDYTN 231
            |.:.||.           :..|::.:|....:|:||.....|:....|.... ..:|.|::   .
Human   147 FPAPRDCNPHCPWRCDGPTCSHYTQMVWASSNRLGCAIHTCSSISVWGNTWHRAAYLVCNY---A 208

  Fly   232 VNGSYV----YKTGKATTGC 247
            :.|:::    ||.||..:.|
Human   209 IKGNWIGESPYKMGKPCSSC 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 34/179 (19%)
R3HDMLNP_848586.1 SCP 65..207 CDD:320774 33/173 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151179
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.