DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and Crisp3

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_033769.1 Gene:Crisp3 / 11572 MGIID:102552 Length:241 Species:Mus musculus


Alignment Length:246 Identity:50/246 - (20%)
Similarity:93/246 - (37%) Gaps:63/246 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ASIPDTL---KVRKDTLAVLNTFRDMLAGGELDTAEN----KTFPSAKRMRALQWDSELAYMART 114
            |.:|.:|   ..::::|..|:|.:..:. .|:.:..|    |..||...:..::|:.:....|:.
Mouse    12 AVLPPSLLQDNSQENSLEKLSTSKKSVQ-EEIVSKHNQLRRKVSPSGSDLLNMEWNYDAQVNAQQ 75

  Fly   115 HAATVSFMHS--ECRST-LRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTVQ----DP 172
            .|...:|.||  |.|:| |:   .||.|.:|                 :::......:|    :.
Mouse    76 RADKCTFSHSPIELRTTNLK---CGENLFMS-----------------SYLVPWSSVIQGWYNES 120

  Fly   173 QSFARRFDSKRDYS-VGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCHFLTCHF-DYTNVNGS 235
            :........|::.| |||.:.:|.....:|.||.|   .|.::   ...:|..|.: ...|.:|.
Mouse   121 KGLIFGVGPKQNVSVVGHHTQVVWKSNLQVACGVA---ECPEN---PLRYFYVCRYCPVLNYSGH 179

  Fly   236 YVYKTGKATTG----------CNDWKTIASIKYSNL----------CENTG 266
            |..:...|.|.          |.|.....|.:|.::          |::.|
Mouse   180 YPSRPYLAYTARAPCASCPDRCEDGLCTKSCQYKDMSFWCKRLEYVCKHPG 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 36/174 (21%)
Crisp3NP_033769.1 SCP 37..172 CDD:294090 33/161 (20%)
Crisp 194..241 CDD:285731 6/37 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841458
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.