DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and Crisp1

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_033768.3 Gene:Crisp1 / 11571 MGIID:102553 Length:244 Species:Mus musculus


Alignment Length:215 Identity:50/215 - (23%)
Similarity:85/215 - (39%) Gaps:57/215 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LKVRKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHS--E 125
            :.|:::.::..|..|.|::            ||...:..::|:.:....|:..|...:|.||  |
Mouse    36 MSVQEEIVSKHNQLRRMVS------------PSGSDLLKMEWNYDAQVNAQQWADKCTFSHSPIE 88

  Fly   126 CRST-LRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTVQDPQSFARRFD---SKRDYS 186
            .|:| ||   .||.|.:|..:....|..:       ..::|||.:        .:|   .:.|..
Mouse    89 LRTTNLR---CGENLFMSSYLASWSSAIQ-------GWYNEYKDL--------TYDVGPKQPDSV 135

  Fly   187 VGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCHFLTCHFDYTNVNGSY------VYKTGKATT 245
            |||::.:|.:...:|.||.|   .|.|:   ...::..||  |..| |:|      .|..|:...
Mouse   136 VGHYTQVVWNSTFQVACGVA---ECPKN---PLRYYYVCH--YCPV-GNYQGRLYTPYTAGEPCA 191

  Fly   246 GCNDWKTIASIKYSNLCENT 265
            .|.|...      ..||.|:
Mouse   192 SCPDHCE------DGLCTNS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 38/167 (23%)
Crisp1NP_033768.3 SCP_CRISP 37..172 CDD:240183 40/172 (23%)
Crisp 190..244 CDD:285731 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841457
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.