DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and GLIPR1

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_006842.2 Gene:GLIPR1 / 11010 HGNCID:17001 Length:266 Species:Homo sapiens


Alignment Length:215 Identity:53/215 - (24%)
Similarity:81/215 - (37%) Gaps:58/215 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 KDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLR 131
            ||.:.:.|.||            ::..|:|..|..:.||..||.:|:..|:...|.|:       
Human    35 KDCVRIHNKFR------------SEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHN------- 80

  Fly   132 FPLAGEVLALSPPVGHRL--SLTEL----------LRMVFAHIFDEYKTVQDPQSFARRFDSKRD 184
                   ..|.||  |:|  :.|.|          :..|.:.|.:.|..:|| ..|..|...|  
Human    81 -------TRLKPP--HKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQD-YDFKTRICKK-- 133

  Fly   185 YSVGHFSIIVNDRVSRVGCGFAVGSNCEK----DGKVGFCHFLTCHFDYTNVNGSYVYKTGKATT 245
             ..||::.:|.....:|||....   |.|    |......||: |::.......::.||.|...:
Human   134 -VCGHYTQVVWADSYKVGCAVQF---CPKVSGFDALSNGAHFI-CNYGPGGNYPTWPYKRGATCS 193

  Fly   246 GC-NDWKTIASIKYSNLCEN 264
            .| |:.|.:     .|||.|
Human   194 ACPNNDKCL-----DNLCVN 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 43/176 (24%)
GLIPR1NP_006842.2 SCP_GLIPR-1_like 32..178 CDD:240185 43/178 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151242
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.