DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and LOC101732829

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_017949574.2 Gene:LOC101732829 / 101732829 -ID:- Length:290 Species:Xenopus tropicalis


Alignment Length:229 Identity:49/229 - (21%)
Similarity:76/229 - (33%) Gaps:67/229 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 YASIP----------DTLKVRKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAY 110
            |.::|          |....|:..:.|.|.:|.           |.| |:|..|..::|:.|.|.
 Frog    62 YGAVPIIVPYETQSTDNATNRQIIVDVHNRWRG-----------NVT-PTAMNMLKMEWNDEAAK 114

  Fly   111 MARTHAATVSFMHSEC--RSTLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTV---Q 170
            .|...|.|.:..|:..  |:...|.....:...|.......::|..        |||.|..   :
 Frog   115 KAEIWARTCNQFHNPASQRNITNFSCGQNLFMASYSTTWEAAVTAW--------FDEIKDFDFGK 171

  Fly   171 DPQSFARRFDSKRDYSVGHFS--IIVNDRVSRVGCGFAVGSNCEKDGKVGFCHFLTCHF-DYTNV 232
            .|::|..        .:||::  ...|.|:  |||......|.|      :.::..||: ...|:
 Frog   172 GPKTFGA--------LIGHYTQGAWYNSRM--VGCYEFECPNAE------YRYYYVCHYCPAGNI 220

  Fly   233 NGSYV--YKTGKATTGCNDWKTIASIKYSNLCEN 264
            .|...  ||.|.....|           ...|||
 Frog   221 EGKQFTPYKIGPTCGDC-----------PKSCEN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 37/169 (22%)
LOC101732829XP_017949574.2 CAP 80..217 CDD:412178 37/172 (22%)
Crisp 234..289 CDD:400739 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.