DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and crisp2-like

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001188271.2 Gene:crisp2-like / 100495843 -ID:- Length:207 Species:Xenopus tropicalis


Alignment Length:181 Identity:38/181 - (20%)
Similarity:60/181 - (33%) Gaps:66/181 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 PSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLRFPLAGEVLALSPPVGHRLSLTELLRMV 158
            |:||.|..::|....|..|:..||.....||                         |.||  |.:
 Frog    51 PTAKDMLKMEWSPGAALNAQNAAAKCVMQHS-------------------------SATE--RQI 88

  Fly   159 ---FAHIFDE--YKTVQDPQSFA---RRFDSKRDYS----------VGHFSIIVNDRVSRVGCGF 205
               |.::..|  |.|...|...|   ..|:.:.|::          :||::.:...:...:|||.
 Frog    89 QDPFNYVCGENIYVTTAKPDWAAAVNSWFNERNDFTYGVGPNSDKMIGHYTQVAWAKTYLLGCGL 153

  Fly   206 AVGSNCEKDGKVGFC------HFLTCHF-DYTNVNGSY--VYKTGKATTGC 247
            |            ||      :...||: ...|:..|.  .|:.|:....|
 Frog   154 A------------FCPGNYYPYVSICHYCPMGNMINSIKTPYEAGEWCASC 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 33/158 (21%)
crisp2-likeNP_001188271.2 SCP 33..171 CDD:320774 33/158 (21%)
Crisp 189..>205 CDD:312162 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.