DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and r3hdml

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_017953344.1 Gene:r3hdml / 100492715 XenbaseID:XB-GENE-1011048 Length:253 Species:Xenopus tropicalis


Alignment Length:291 Identity:54/291 - (18%)
Similarity:103/291 - (35%) Gaps:80/291 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSI---LLLAGLLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKYYASIPDT 62
            ||.|   :..:|:.|.:.|:::.: ..:..|.:..|:.|.......|...|...|.:|.:.    
 Frog     1 MTLIHLPIFFSGVFLWITPLLSAF-LLDRATELLSLSNRNQTEHMFGSGIPRIRRKRYISP---- 60

  Fly    63 LKVRKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECR 127
                :|..|:|:....:         .:|.||.|..|..:.||..||..|.:.|....:.|.. .
 Frog    61 ----RDMSALLDYHNQV---------RSKVFPPAANMEYMVWDERLAKSAESWANQCKWDHGP-N 111

  Fly   128 STLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTVQDPQSFARRFDSKRDYS------ 186
            ..:|:            :|..||:..          ..|:::.|  .....:|.::.||      
 Frog   112 QLMRY------------IGQNLSVHS----------GRYRSIVD--LVKGWYDERQHYSFPHPRE 152

  Fly   187 -------------VGHFSIIVNDRVSRVGCGFAVGSNCEKDGKV-GFCHFLTCHFDYTNVNGSYV 237
                         ..|::.:|....:|:||...:.:|....|.. ....:|.|::   ::.|:::
 Frog   153 CNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNY---SIKGNWI 214

  Fly   238 ----YKTGKATTGCNDWKTIASIKYSNLCEN 264
                ||.|:..:.|..       .|..:|.|
 Frog   215 GEAPYKLGRPCSACPP-------SYGGVCSN 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 33/181 (18%)
r3hdmlXP_017953344.1 CAP_R3HDML 63..208 CDD:349409 32/181 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.