DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and crispld1

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_002937123.2 Gene:crispld1 / 100490431 XenbaseID:XB-GENE-989389 Length:514 Species:Xenopus tropicalis


Alignment Length:319 Identity:64/319 - (20%)
Similarity:102/319 - (31%) Gaps:128/319 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TSILLLA-GLLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGE---LKPYGGRAKYYASIPDT 62
            |.:|.:| .::.|::|         |.|.:..|.::  :|...||   .|..|.||         
 Frog    12 TVLLFIAQSVVTLVIP---------NATQLEGLLEK--YMDEDGEWWTAKHRGKRA--------- 56

  Fly    63 LKVRKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECR 127
              :.:..:.::....:.|.|        :.:|.|..|..:.||.||...|...|.|..:.|... 
 Frog    57 --ITESDMKLILDLHNKLRG--------EVYPPASNMEFMIWDVELERSAEAWAETCLWEHGPA- 110

  Fly   128 STLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTVQDPQSFARR--FDSKRDYS---- 186
                        .|.|.:|..|.         || :..|:    |.::..:  :|..|||:    
 Frog   111 ------------DLLPVIGQNLG---------AH-WGRYR----PPTYHVQAWYDEVRDYTFPYP 149

  Fly   187 ---------------VGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCH-------------FL 223
                           ..|::.:|....||:||.            :..||             :|
 Frog   150 QECDPYCPFRCSGPVCTHYTQLVWATSSRIGCA------------INLCHNMNVWGQIWPKAIYL 202

  Fly   224 TCHFD-YTNVNGSYVYKTGKATT--------GCNDWKTIASIKYSNLCENTGE--IFPL 271
            .|::. ..|..|...||.|...:        ||.|          |||...|.  .:||
 Frog   203 VCNYSPKGNWWGHAPYKHGHPCSACPPSYGGGCKD----------NLCYKDGSDLHYPL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 35/195 (18%)
crispld1XP_002937123.2 CAP_CRISPLD1 62..207 CDD:349407 35/191 (18%)
LCCL 304..388 CDD:128866
LCCL 407..506 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.