DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and pi15

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_002937120.1 Gene:pi15 / 100489915 XenbaseID:XB-GENE-989406 Length:258 Species:Xenopus tropicalis


Alignment Length:246 Identity:55/246 - (22%)
Similarity:87/246 - (35%) Gaps:60/246 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 AKYYASIPDTLKVRKDTLAVLNTFR-------DMLAGGEL-DTAENKTFPSAKRMRALQWDSELA 109
            |..|..|...|..|.|...|....|       ||:|..|. :....|.||.|..|..:.||..||
 Frog    34 ASNYTIIKPDLSARLDAAKVPKARRKRYISQNDMIAIVEYHNQVRGKVFPPAANMEYMVWDENLA 98

  Fly   110 YMARTHAATVSFMHSECRSTLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFD---EYKTVQD 171
            .:|...|||..:.|.. ...|:|  .|:  .||...|...|:.:|::..:..:.|   .|....:
 Frog    99 KLAEAWAATCIWDHGP-SYLLKF--LGQ--NLSVRTGRYKSILQLVKPWYDEVKDYAFPYPQECN 158

  Fly   172 PQSFARRFDSKRDYSVGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCH-------------FL 223
            |:...|.:..    ...|::.:|....:|:||.            :..||             :|
 Frog   159 PRCPLRCYGP----MCTHYTQMVWATTNRIGCA------------IHTCHNMNVWGAVWRRAVYL 207

  Fly   224 TCHFDYTNVNGSYV----YKTGKATTGCNDWKTIASIKYSNLCENTGEIFP 270
            .|::   :..|:::    |..|...:.|..       .|...|.: .:.||
 Frog   208 VCNY---SPKGNWIGEAPYTIGVPCSACPP-------SYGGSCSD-NQCFP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 43/185 (23%)
pi15XP_002937120.1 CAP_PI15 67..212 CDD:349408 38/168 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.