DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and glipr2

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001107504.1 Gene:glipr2 / 100135358 XenbaseID:XB-GENE-5758336 Length:441 Species:Xenopus tropicalis


Alignment Length:228 Identity:46/228 - (20%)
Similarity:75/228 - (32%) Gaps:66/228 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKYYASIPDTLKV-----------RK 67
            :|.:||.||...|.|:.....  ::.:.|..::...||....:...|.:..|           ||
 Frog   236 MLIVVAQYNPSGNITNPGFYG--RNVLPRGSKVTDDGGDEDGFVKSPSSTAVLPIPEKELKSFRK 298

  Fly    68 DTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELA-----YMARTHAATVSFMHSECR 127
            |.|:..|.:|.:...|.|..:      .|....|.:|...|.     ..:.||.....:...|..
 Frog   299 DLLSEHNQYRKLHGAGALQLS------VALSQDAQKWADHLVGKPALQNSDTHHGENLWYRWETN 357

  Fly   128 STLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTVQDPQSFAR-RFDSKRDYSVGHFS 191
            ::|             |.|..::             :.:.......|||. .|.|    ..|:|:
 Frog   358 TSL-------------PTGKEVA-------------ESWYNENAKYSFATPGFQS----GSGNFT 392

  Fly   192 IIVNDRVSRVGCGFAVGSNCEKDGK-----VGF 219
            .::....|:||.|.:.      |.|     |||
 Frog   393 QMIWKSSSQVGFGLST------DNKGMYIAVGF 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 34/165 (21%)
glipr2NP_001107504.1 SCP <3..69 CDD:294090
SCP_GAPR-1_like 118..249 CDD:240182 5/12 (42%)
SCP_GAPR-1_like 295..426 CDD:240182 34/167 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.