DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and XB5812873

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_031758624.1 Gene:XB5812873 / 100127722 XenbaseID:XB-GENE-5812874 Length:272 Species:Xenopus tropicalis


Alignment Length:293 Identity:62/293 - (21%)
Similarity:87/293 - (29%) Gaps:99/293 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSILLLAGLLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKYYASIPDTLKV 65
            ::|.|.:.|.||||                          |.....||        .|..|::: 
 Frog    25 LSSFLEMNGFLLLL--------------------------CLASLSKP--------TSEQDSVE- 54

  Fly    66 RKDTLAVLNTFRDMLAGGELDTAENKTF-------------PSAKRMRALQWDSELAYMARTHAA 117
                     :|.:|    ..|...|:.|             |.|..|..:.||:.....|:..|.
 Frog    55 ---------SFDEM----STDLESNRNFIVDKHNYYRSWVNPPAADMLKMHWDNYYLAKAKEWAL 106

  Fly   118 TVSFMHSECRSTLRF-----PLAGEVLALSPPVGHRLSLTELLRMVF-AHIFDEYKTVQDPQSFA 176
            |.||.|    |.|.|     ..|||.:..|   ..|.|...::...| .|:..||..        
 Frog   107 TCSFKH----SNLSFRQYGGEFAGENIMNS---YFRHSWEYVINYWFNEHVNWEYAV-------- 156

  Fly   177 RRFDSKRDYSVGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCHFLTCHFDYTNVNGSYVYKT- 240
              ..:|.....|||:.|:......:.|..|      |.....:.:|..|.: |...|.....|| 
 Frog   157 --GTTKEGAVTGHFTQIIWAPTHALACYVA------KCYGTPYNYFYVCIY-YPTGNREDKVKTP 212

  Fly   241 -------GKATTGCNDWKTIASIKYSNLCENTG 266
                   |.....|:|...:....|.|...|.|
 Frog   213 YQNGTTCGLCQKDCDDQLCLNYCPYYNSAGNCG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 39/180 (22%)
XB5812873XP_031758624.1 CAP 65..201 CDD:412178 36/159 (23%)
Crisp 219..269 CDD:400739 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.