DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and R3hdml

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001092801.1 Gene:R3hdml / 100043899 MGIID:3650937 Length:253 Species:Mus musculus


Alignment Length:283 Identity:59/283 - (20%)
Similarity:94/283 - (33%) Gaps:94/283 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSILLLAGLLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKYYA-------S 58
            ::||:.|.||||.:...|......|.     .|.|               ||.|..|       .
Mouse     4 LSSIVGLTGLLLWMGHTVGALRMPNT-----TLVQ---------------GRPKNTAVWPLSGLG 48

  Fly    59 IPDTLKVR----KDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATV 119
            :|...:.|    :|..|:|:....:.|         ...|.|..|..:.||.:||..|...|...
Mouse    49 VPRHRRKRHISARDMSALLDYHNHIRA---------SVHPPAANMEYMVWDEQLARSAEAWATQC 104

  Fly   120 SFMHSECRSTLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTVQD-PQSFARRFDSKR 183
            .:.|...:             |...||..||:..          ..:::|.| .:|::   :.||
Mouse   105 IWTHGPSQ-------------LMKYVGQNLSIHS----------GRFRSVVDLVRSWS---EEKR 143

  Fly   184 DYS-------------------VGHFSIIVNDRVSRVGCGFAVGSNCEKDGKV-GFCHFLTCHFD 228
            .||                   ..|::.:|....||:||.....|:....|.. ....:|.|:: 
Mouse   144 HYSFPAPKDCTPHCPWLCSGPVCSHYTQMVWASSSRLGCAINTCSSINVWGNTWQQAVYLVCNY- 207

  Fly   229 YTNVNGSYV----YKTGKATTGC 247
              .:.|:::    ||.||..:.|
Mouse   208 --AIKGNWIGEAPYKAGKPCSAC 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 37/186 (20%)
R3hdmlNP_001092801.1 CAP_R3HDML 63..208 CDD:349409 35/182 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841256
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.