DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3253 and Gxylt2

DIOPT Version :9

Sequence 1:NP_001246488.1 Gene:CG3253 / 37861 FlyBaseID:FBgn0041706 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_001066466.1 Gene:Gxylt2 / 688618 RGDID:1586482 Length:444 Species:Rattus norvegicus


Alignment Length:353 Identity:76/353 - (21%)
Similarity:110/353 - (31%) Gaps:140/353 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SSEGSLVCLATQTSVERLNSLPQVAANWQGKMSVALFAAG---PEEFVVLQYFVTYMRLCFANIR 107
            :|.|.|.  .....|..|:|:|...  |   :.:|:.|.|   .|..|:|:..|.:.       .
  Rat    87 ASRGKLA--RRSGEVRSLHSVPPEL--W---IHLAVVACGNRLEETLVMLKSAVLFS-------H 137

  Fly   108 ENATFHLLT----PRDFDKLPRVAALPLNMRGKFDCQYPDRTLKALLKF-RSLKTLQWRQRNTYP 167
            ....||:.|    ..:|||..|              |:||...|   || ..|..:.:...|  |
  Rat   138 RKMRFHIFTEDALKPEFDKQLR--------------QWPDSYTK---KFEHKLYPITFSVGN--P 183

  Fly   168 QNHMRNLARKGCQTKYVFL------------TDIDIVPSTNSVPQLNHFFRTANCTKSCAYVIPT 220
            |...:..  |.|..:.:||            .|.|:: ....|..:....|..|.|:..| :.|.
  Rat   184 QEWKKLF--KPCAAQRLFLPVILKDVDSLLYVDTDVL-FLRPVDDIWKLLRQFNSTQLAA-MAPE 244

  Fly   221 FEID------------------------------VRATFPRSKNALVRLIRKGLA-----RPFHE 250
            .||.                              :|:|  :.||:   ||..|||     .|.::
  Rat   245 HEIPKIGWYSRFARHPFYGSAGVNSGVMLMNLTRIRST--QFKNS---LIPTGLAWEEMLLPLYQ 304

  Fly   251 K---------------VFIYN-----------QYATNFSKWLSPNTNETE---VSVSH------- 279
            |               :|.:|           .|..:...:.| |..|.|   |||.|       
  Rat   305 KYKNAITWGDQDLLNIIFYFNPECLYVFPCQWNYRPDHCMYGS-NCKEAEREGVSVLHGNRGVYH 368

  Fly   280 --VVTNFEFLYEPFYIAVDNAPAHDERF 305
              ....|..|||    |:.:.|..|..|
  Rat   369 DDKQPTFRALYE----AIRDFPFRDNLF 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3253NP_001246488.1 Glyco_transf_49 52..371 CDD:290607 73/347 (21%)
Gxylt2XP_001066466.1 GT8_like_2 111..414 CDD:133052 68/322 (21%)
RfaJ 127..396 CDD:224359 64/306 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.