powered by:
Protein Alignment CG3253 and gxylt2
DIOPT Version :9
Sequence 1: | NP_001246488.1 |
Gene: | CG3253 / 37861 |
FlyBaseID: | FBgn0041706 |
Length: | 389 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001103670.1 |
Gene: | gxylt2 / 567541 |
ZFINID: | ZDB-GENE-070424-64 |
Length: | 441 |
Species: | Danio rerio |
Alignment Length: | 66 |
Identity: | 17/66 - (25%) |
Similarity: | 29/66 - (43%) |
Gaps: | 12/66 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 233 KNALVRLIRKGLARPFHEKVFIYNQYATNFSKWLSPNTNETEVSVSHVVTNFEFLYEPFYIAVDN 297
|:||:..::|.....|.|: .:..|:...||:| |.| :.:.|.:...|...:|.|
Zfish 128 KSALLFSMKKIKFHIFAEE-DLAEQFERGFSQW--PQT---------LSSRFHYSIYPITFSVGN 180
Fly 298 A 298
|
Zfish 181 A 181
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3765 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.