DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3253 and gxylt2

DIOPT Version :9

Sequence 1:NP_001246488.1 Gene:CG3253 / 37861 FlyBaseID:FBgn0041706 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001103670.1 Gene:gxylt2 / 567541 ZFINID:ZDB-GENE-070424-64 Length:441 Species:Danio rerio


Alignment Length:66 Identity:17/66 - (25%)
Similarity:29/66 - (43%) Gaps:12/66 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 KNALVRLIRKGLARPFHEKVFIYNQYATNFSKWLSPNTNETEVSVSHVVTNFEFLYEPFYIAVDN 297
            |:||:..::|.....|.|: .:..|:...||:|  |.|         :.:.|.:...|...:|.|
Zfish   128 KSALLFSMKKIKFHIFAEE-DLAEQFERGFSQW--PQT---------LSSRFHYSIYPITFSVGN 180

  Fly   298 A 298
            |
Zfish   181 A 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3253NP_001246488.1 Glyco_transf_49 52..371 CDD:290607 17/66 (26%)
gxylt2NP_001103670.1 GT8_like_2 109..412 CDD:133052 17/66 (26%)
RfaJ 109..>340 CDD:224359 17/66 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.