DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3253 and large1

DIOPT Version :9

Sequence 1:NP_001246488.1 Gene:CG3253 / 37861 FlyBaseID:FBgn0041706 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001004537.1 Gene:large1 / 446213 ZFINID:ZDB-GENE-061204-1 Length:757 Species:Danio rerio


Alignment Length:414 Identity:94/414 - (22%)
Similarity:155/414 - (37%) Gaps:126/414 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FDNINLSYGRWDNQLL---------------------------------YRIKDFAL-------L 39
            |.|:.|::..:|..||                                 :|.:.|.:       |
Zfish   398 FRNLYLTFLEYDGNLLRRELFGCPSETDHNSENLQKTLSELDEDDPCYEFRRERFTVHRTHVYFL 462

  Fly    40 GEQYVDSSEGSLVCLATQTSVERLNSLPQVAANWQGKMSVALFAAGPEEFVVLQYFVTYMRLCFA 104
            ..:|..:.:.:.|.|..|.|::||..|..:..:|:|.:|:||:.:..|    .|.|:.|.:....
Zfish   463 HYEYEPTVDNTDVTLVAQLSMDRLQMLEAICKHWEGPISLALYLSDAE----AQQFLRYAQGSEV 523

  Fly   105 NI-RENATFHLLTPRDFDKLPRVAALPLNMRGKFDCQYPDRTLKALLKFRSLKTLQWRQRNTYPQ 168
            .: |.|..:|::                                            :::...||.
Zfish   524 LMSRSNVGYHIV--------------------------------------------YKEGQFYPV 544

  Fly   169 NHMRNLARKGCQTKYVFLTDIDIVPS-------TNSVPQLNHFFRTANCTKSCAYVIPTFE-IDV 225
            |.:||:|.....|.|:||:|||.:|.       ..||.||:    ..|..|  |.|:|.|| :..
Zfish   545 NLLRNVAMGQVNTPYMFLSDIDFLPMYGLYEYLRKSVVQLD----MGNTKK--ALVVPAFETLRY 603

  Fly   226 RATFPRSKNALVRLIRKGLARPFHEKVFIYNQYATNFSKWLSPNTNETEVSVSHVVTNFEFLYEP 290
            |.:||:||..|:..:..|....|...|:......|:|:||   .|..|...|     .:|..:||
Zfish   604 RLSFPKSKAELLSQLDMGTLFTFRYHVWTKGHAPTDFAKW---RTATTPYRV-----QWEADFEP 660

  Fly   291 FYIAVDNAPAHDERFLGYGFTRNSQVYEMHIAGYQFYVLSPVFTGHWG----------LQRKQAR 345
            :.:....:|.:|.||:|:|:.:.:.:.|:....|:|.||...:..|..          ...||.|
Zfish   661 YVMVRRESPEYDRRFVGFGWNKVAHIMELDAQEYEFVVLPNAYMIHMPHAPSFDITKFRSNKQYR 725

  Fly   346 PAWRE-----QQNNANRRKFDVFK 364
            ...:.     |||.:.|..|...|
Zfish   726 ACLKTLKEEFQQNMSRRYGFAALK 749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3253NP_001246488.1 Glyco_transf_49 52..371 CDD:290607 84/337 (25%)
large1NP_001004537.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..127
RfaJ 137..>387 CDD:224359
GT8_LARGE_C 139..418 CDD:133053 6/19 (32%)
Xylosyltransferase activity. /evidence=ECO:0000250|UniProtKB:O95461 139..414 5/15 (33%)
Glucuronyltransferase activity. /evidence=ECO:0000250|UniProtKB:O95461 415..757 88/397 (22%)
Glyco_transf_49 474..743 CDD:290607 81/330 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D729091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.