DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3253 and Xxylt

DIOPT Version :9

Sequence 1:NP_001246488.1 Gene:CG3253 / 37861 FlyBaseID:FBgn0041706 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster


Alignment Length:378 Identity:73/378 - (19%)
Similarity:119/378 - (31%) Gaps:120/378 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VERLNSLPQVAANWQGKMSVALFAAGPEEFVVLQYFV-TYMRLCFAN----IRENATFHLLTPRD 119
            :.|.||:.|...:|...:   |.....::.|:|..|: ..:.:.|||    :|.|.....|:.| 
  Fly    43 INRRNSIRQKPKSWAWTL---LRCRWQKKLVLLLIFICVCVLIVFANTHLLVRGNILSAFLSSR- 103

  Fly   120 FDKLPRVAALPLNMRG---KFDCQYPD------------RTLKALLKFRSLKTLQWRQRNTYP-- 167
                       ||...   |.:.:|||            |....||.:.|.:.......|...  
  Fly   104 -----------LNKHSHAEKQEARYPDIPATTPSVPPVLRPTHYLLNYSSTQLELSSHLNGLSSD 157

  Fly   168 ---------QNHMRN----------LARKGCQTKYVFLTDIDIVPSTNSV--PQLNHFFRTANCT 211
                     :|:..|          |.....|.....:||.:..||...:  .|:..|.||...|
  Fly   158 YNIFVIYTRENYHLNLKFDLFAHSLLKHTSAQLHLHVITDSESQPSVLEILQRQIRRFRRTVIYT 222

  Fly   212 ----KSCAYVIPTFEIDVRATFPRSKNA------------LVRLIRKGLARP--------FHEKV 252
                |.|:.:|......:...|..:.|:            |.|:..:.|.|.        |...|
  Fly   223 IYDVKVCSSIIQDIAAKLSPYFSSTPNSYYSDSLFFLSLGLHRIADRSLNRAILLDCDIVFRSDV 287

  Fly   253 -FIYNQYATNFSKWLSPNTNETEVSVSHVVTNFEFLY------EPFYIAVDNAPAHDERFLGYGF 310
             .::|::.......|.....|......|::..:...|      .|:| .::|...:....:.:|:
  Fly   288 RLLFNEFDNFLPHQLYGLAPELTPVYRHILYRYRVRYPKTSFGNPYY-PINNEGGNQHSRVHHGY 351

  Fly   311 --------------TRNSQVY-------EMH--IAGYQFYVLSPVFTGHWGLQ 340
                          .|||:.|       |:|  :|.|.       |.||.|.|
  Fly   352 PGLNSGVVLLLLNRIRNSKSYLEKLTHSEVHTLVAKYS-------FKGHLGDQ 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3253NP_001246488.1 Glyco_transf_49 52..371 CDD:290607 73/378 (19%)
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 45/234 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.