DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3253 and Large1

DIOPT Version :9

Sequence 1:NP_001246488.1 Gene:CG3253 / 37861 FlyBaseID:FBgn0041706 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001101909.1 Gene:Large1 / 361368 RGDID:1308895 Length:385 Species:Rattus norvegicus


Alignment Length:60 Identity:15/60 - (25%)
Similarity:22/60 - (36%) Gaps:15/60 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 ATNFSKWLSP-------NTNETEVSVSHVVTNFEFLYEPFY-----IAVDNAPAHDERFL 306
            ||.|..|:.|       |.:|.:..||.:....   |...|     :.....||:.||.:
  Rat   183 ATLFQTWMVPAVRVDFYNADELKSEVSWIPNKH---YSGIYGLMKLVLTKTLPANLERVI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3253NP_001246488.1 Glyco_transf_49 52..371 CDD:290607 15/60 (25%)
Large1NP_001101909.1 RfaJ 136..>359 CDD:224359 15/60 (25%)
GT8_LARGE_C 138..377 CDD:133053 15/60 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D729091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.