DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3253 and CG9171

DIOPT Version :9

Sequence 1:NP_001246488.1 Gene:CG3253 / 37861 FlyBaseID:FBgn0041706 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001162891.1 Gene:CG9171 / 33807 FlyBaseID:FBgn0031738 Length:544 Species:Drosophila melanogaster


Alignment Length:427 Identity:100/427 - (23%)
Similarity:162/427 - (37%) Gaps:98/427 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GFVVPNNSASL---------AFDNINLSYGRWDNQLLYRIKDFALLGEQYVDSSEGSLVC----- 53
            |::|..:...|         .||:      .:..|.|.| .||.:| :.||.:..|.:.|     
  Fly   158 GYIVTGDEKELEERVRSLINCFDH------DYHQQTLQR-GDFWVL-QNYVRAEHGDIKCHESIT 214

  Fly    54 LATQTSVERLNSLPQVAANWQGKMSVALFAAGPEEFVVLQYFVTYMRLCFAN---IRENATFHLL 115
            ..|......|::|..:...|...:|:|:.|.| .:|......:.|:|.|...   :|...|||:.
  Fly   215 YTTHADYTFLDNLVPLLERWNAPVSIAMHAPG-TDFQPTLDSIRYLRECLPGSHLVRAYTTFHIY 278

  Fly   116 -----TPRDFDKLPRVAALPLNMRGKFDCQYPD-----------RTLKALLKFRSLKTLQWRQRN 164
                 .|:...|...|      .:..::|..|.           :..|.||              
  Fly   279 FGTKHIPKSVPKPHEV------FKTGYNCTLPPPYFNVSSGHLYKAQKKLL-------------- 323

  Fly   165 TYPQNHMRNLARKGCQTKYVFLTDIDIVPSTNSVPQ-LNHFFRTANCTKSCA---YVIPTFEIDV 225
             ||.|..||:||....|.::..:||::.|:...|.: |....|.....:..|   :.:..||::.
  Fly   324 -YPVNVGRNIARDSALTHFILASDIELYPNPGLVKKFLEMIARNEQYLRRKAPRVFPLAIFEVEE 387

  Fly   226 RATFPRSKNALVRLIRKGLARPFHEKVFIYNQYATNFSKWLSPNTNETEVSVSHV--VTNFEFLY 288
            .:..|..|..|...:|.|.|.|||::|...........:|:|.|..: |:||.|:  .|.:...:
  Fly   388 NSPVPHDKTELQEFLRTGKAIPFHKRVCASCHGVPKSKEWMSANETD-ELSVFHIGKRTGYYVHW 451

  Fly   289 EPFYIAVDNAPAHDERFLGYGFT-RNSQVYEMHIAGYQFYVLSPVFTGHWGLQRKQARPAWREQQ 352
            ||.||.....|.:|||....|.: :..|.|.:.:..|:|::|...|..|                
  Fly   452 EPIYIGTHADPHYDERLSWEGKSDKMPQGYALCVMDYEFHILDNAFLVH---------------- 500

  Fly   353 NNANRRKFDVFKSEIFVRYKNDPRLLLKAKKNQILVK 389
                       |..|.|..|::.|.:|..|.||::.|
  Fly   501 -----------KPGIKVLKKDNRRAMLSGKTNQLIRK 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3253NP_001246488.1 Glyco_transf_49 52..371 CDD:290607 79/349 (23%)
CG9171NP_001162891.1 Glyco_transf_49 212..536 CDD:290607 85/365 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D485184at33208
OrthoFinder 1 1.000 - - FOG0003642
OrthoInspector 1 1.000 - - otm14638
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5095
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.