DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3253 and GXYLT1

DIOPT Version :9

Sequence 1:NP_001246488.1 Gene:CG3253 / 37861 FlyBaseID:FBgn0041706 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_775872.1 Gene:GXYLT1 / 283464 HGNCID:27482 Length:440 Species:Homo sapiens


Alignment Length:320 Identity:63/320 - (19%)
Similarity:104/320 - (32%) Gaps:107/320 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LLYRIKDFALLGEQYVDSSEGSLVCLATQTSVERLNSLPQVA-ANW---QGKMSV-ALFAAGP-- 86
            |||.....|:..|:......|.                ||.| |:|   .|:.:| ....|||  
Human    19 LLYAFSQLAVSLEEGTGGGGGK----------------PQAAVASWLAGGGRGAVRGAGVAGPAA 67

  Fly    87 --------EEFVVLQYFVTYMRL----CFANIRENATF------------HLLTPRDFDKLPRVA 127
                    ::| .|.|:..|..|    |..|....|.|            ||......::|....
Human    68 HPGVSDRCKDF-SLCYWNPYWMLPSDVCGMNCFWEAAFRYSLKIQPVEKMHLAVVACGERLEETM 131

  Fly   128 ALPLNMRGKFDCQYPDRTLKALLKFRSLKTLQWRQRNTYPQNHMRNLARKGCQTKYVFLTDIDIV 192
            .:                ||:.:.| |:|.||:   :.:.::.:.: :.||....:.||...:..
Human   132 TM----------------LKSAIIF-SIKPLQF---HIFAEDQLHH-SFKGRLDNWSFLQTFNYT 175

  Fly   193 ------PSTNSVPQLNHFFRTANCTKSCA-----------YVIPTFEIDVRATFPRSKNALVRLI 240
                  ||.|:......|       |.||           .|.....:|....|.|..:.:..|:
Human   176 LYPITFPSENAAEWKKLF-------KPCASQRLFLPLILKEVDSLLYVDTDILFLRPVDDIWSLL 233

  Fly   241 RK------GLARPFHEKVFI--YNQYATNFSKWLSPNTNETEVSVSHVVTNFEFLYEPFY 292
            :|      ....|.||:..|  ||::|.:      |...:|.|:...::.|...:...::
Human   234 KKFNSTQIAAMAPEHEEPRIGWYNRFARH------PYYGKTGVNSGVMLMNMTRMRRKYF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3253NP_001246488.1 Glyco_transf_49 52..371 CDD:290607 57/297 (19%)
GXYLT1NP_775872.1 GT8_like_2 116..417 CDD:133052 38/206 (18%)
RfaJ <184..>345 CDD:224359 22/117 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.