DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3253 and Gxylt2

DIOPT Version :9

Sequence 1:NP_001246488.1 Gene:CG3253 / 37861 FlyBaseID:FBgn0041706 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_941014.1 Gene:Gxylt2 / 232313 MGIID:2682940 Length:444 Species:Mus musculus


Alignment Length:341 Identity:69/341 - (20%)
Similarity:101/341 - (29%) Gaps:148/341 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LNSLPQVAANWQGKMSVALFAAG---PEEFVVLQYFVTYMRLCFANIRENATFHLLT----PRDF 120
            |:|:|...  |   :.:|:.|.|   .|..|:|:..|.:.       .....||:.|    ..:|
Mouse   102 LHSVPPEL--W---IHLAVVACGNRLEETLVMLKSAVLFS-------HRKMRFHIFTEDALKPEF 154

  Fly   121 DKLPRVAALPLNMRGKFDCQYPDRTLKAL------LKFRSLKTLQWRQRNTYPQNHMRNLARKGC 179
            ||..|              |:||...|..      :.|......:|::            ..|.|
Mouse   155 DKQLR--------------QWPDSYTKKFEHRLYPITFSVGNPQEWKK------------LFKPC 193

  Fly   180 QTKYVFL------------TDIDIVPSTNSVPQLNHFFRTANCTKSCAYVIPTFEID-------- 224
            ..:.:||            .|.|:: ....|..:....|..|.|:..| :.|..||.        
Mouse   194 AAQRLFLPAILKDVDSLLYVDTDVL-FLRPVDDIWKLLRQFNSTQLAA-MAPEHEIPKIGWYSRF 256

  Fly   225 ----------------------VRATFPRSKNALVRLIRKGLA-----RPFHEK----------- 251
                                  :|.|  :.||:   ||..|||     .|.::|           
Mouse   257 ARHPFYGSAGVNSGVMLMNLTRIRNT--QFKNS---LIPAGLAWEEMLLPLYQKYKSAITWGDQD 316

  Fly   252 ----VFIYN-----------QYATNFSKWLSPNTNETE---VSVSH---------VVTNFEFLYE 289
                :|.||           .|..:...:.| |..|.|   |||.|         ....|..|||
Mouse   317 LLNIIFYYNPECLYVFPCQWNYRPDHCMYGS-NCKEAEREGVSVLHGNRGVYHDDKQPTFRALYE 380

  Fly   290 PFYIAVDNAPAHDERF 305
                |:.:.|..|..|
Mouse   381 ----AIRDFPFQDNLF 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3253NP_001246488.1 Glyco_transf_49 52..371 CDD:290607 69/341 (20%)
Gxylt2NP_941014.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..101
GT8_like_2 111..414 CDD:133052 65/327 (20%)
RfaJ 127..396 CDD:224359 61/311 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.