DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3253 and Gxylt1

DIOPT Version :9

Sequence 1:NP_001246488.1 Gene:CG3253 / 37861 FlyBaseID:FBgn0041706 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001333714.1 Gene:Gxylt1 / 223827 MGIID:2684933 Length:435 Species:Mus musculus


Alignment Length:250 Identity:50/250 - (20%)
Similarity:82/250 - (32%) Gaps:106/250 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 RTANCTK-SCAY-----VIPT------------FEIDVRATFPRSKNAL------------VRLI 240
            ||..|.: |.:|     ::|:            |..|:: |.|..|..|            |.::
Mouse    66 RTGRCKEFSLSYWNPYWMLPSDVCGMNCFWEAAFRYDMK-TRPDEKMHLAVVACGERLEETVTML 129

  Fly   241 RKGL---ARPFHEKVFI----------------------YNQY--------ATNFSKWLSPNTNE 272
            :..|   .:|.|..:|.                      |:.|        |.::.|...|..::
Mouse   130 KSALIFSIKPLHVHIFAEDQLHDSFKDRLASWSFLRRFDYSLYPITFPGDSAADWKKLFKPCASQ 194

  Fly   273 --------TEV-SVSHVVTNFEFL------------YEPFYIAVDNAPAHDERFLG--------- 307
                    .|| |:.:|.|:..||            :....||. .||.|:|..:|         
Mouse   195 RLFLPLILKEVDSLLYVDTDILFLRPVDDIWSLLKKFNSTQIAA-MAPEHEEPRIGWYNRFARHP 258

  Fly   308 -YGFTR-NSQVYEMHIAGY-QFYVLSPVFTG--HWG------LQRKQARPAWREQ 351
             ||.|. ||.|..|::... :.|..:.:.|.  .||      |::.:....|.:|
Mouse   259 YYGRTGVNSGVMLMNMTRMRRKYFKNDMTTARLQWGDILMPLLKKYKLNITWGDQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3253NP_001246488.1 Glyco_transf_49 52..371 CDD:290607 49/249 (20%)
Gxylt1NP_001333714.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.