DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3253 and bgnt-1.6

DIOPT Version :9

Sequence 1:NP_001246488.1 Gene:CG3253 / 37861 FlyBaseID:FBgn0041706 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_493107.1 Gene:bgnt-1.6 / 186417 WormBaseID:WBGene00010167 Length:388 Species:Caenorhabditis elegans


Alignment Length:368 Identity:78/368 - (21%)
Similarity:126/368 - (34%) Gaps:73/368 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LGEQYVDSSEG------SLVCLATQTSVERLNSLPQVAANWQGKMSVALFAAGPEEFVVLQYFVT 97
            :|..:::::|.      ..|.||...:.:.|..:.:..:||.|.:|..:|.....: ..|:| |.
 Worm    47 IGYNFLEATEKFREDGLEPVTLAIHGTSDVLEVVEKKPSNWDGPISFGMFVDYHSQ-KALEY-VA 109

  Fly    98 YMRLCFANIRENATFHLL---TPRDFD---KLPRVAALPLNMRGKFDCQYPDRTLKALLK----- 151
            .:..|.....|..|.|.:   :|...|   ..|.|:.         :|....|..|.|||     
 Worm   110 MLHQCDKEFGEKVTVHYVFRTSPSQMDCPVITPDVSV---------NCDEFRRNRKQLLKEITSP 165

  Fly   152 FRSLKTLQWRQRNTYPQNHMRNLARKGCQTKYVFLTDIDIVPSTNSV----PQLNHFFRTANCTK 212
            |:           .||.|.|||:||:|..:....:.|.|:..|::..    |..|   |..:..:
 Worm   166 FQ-----------IYPINLMRNVARRGATSDLHLIVDADMTMSSDFARKVKPIAN---RIIDGKQ 216

  Fly   213 SCAYVIPTFEIDVRATFPRSKNALVRLIRKGLARPFHEKVFIYNQYATNFSKWLSPNTNETEVSV 277
            ....|:..||.: ....|.....|...........||...|.......:..||...:..|.||:.
 Worm   217 RQVLVVRRFETN-EDEIPLEVEQLKMGFENQKVFEFHHNFFFIGHKIPDVEKWFHASKTENEVTA 280

  Fly   278 -----------SHVVTNFEFLYEPFYIAVDNAPAHDERFLGYGFTRNSQVYEMHIAGYQFYVLSP 331
                       ..|:.:...:|...|..   :...|.:.|.||..|         |.|.|.:||.
 Worm   281 WEIPYSGNAWEVQVILHRNDMYNAEYFP---SRIRDMQSLIYGLCR---------ANYTFNLLSH 333

  Fly   332 VFTGHWGLQRKQ---ARPAWREQQNNANRRKFDVFKSEIFVRY 371
            ||..|.|::...   ::......:.....|.|..:..|:...|
 Worm   334 VFNVHQGIKEDDTMYSKVVTAHSKRYGRNRAFSRYVHEMNTAY 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3253NP_001246488.1 Glyco_transf_49 52..371 CDD:290607 75/347 (22%)
bgnt-1.6NP_493107.1 Glyco_transf_49 65..376 CDD:290607 75/348 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I6018
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I3878
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49245
OrthoDB 1 1.010 - - D485184at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14638
orthoMCL 1 0.900 - - OOG6_105249
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4907
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.