DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3253 and bgnt-1.2

DIOPT Version :9

Sequence 1:NP_001246488.1 Gene:CG3253 / 37861 FlyBaseID:FBgn0041706 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001300086.1 Gene:bgnt-1.2 / 184865 WormBaseID:WBGene00017723 Length:406 Species:Caenorhabditis elegans


Alignment Length:342 Identity:85/342 - (24%)
Similarity:138/342 - (40%) Gaps:64/342 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KDFALLGEQYVDS-------SEGS---------LVCLATQTSVERLNSLPQVAANWQGKMSVALF 82
            |::::..|.|.|.       .||:         .:.||:..:.:.:.:|.::.:.|.|.:||.:|
 Worm    47 KNYSIQTEMYEDQYCVGYNFLEGTGDFREDGLEPITLASHATSDMMLTLEKMTSMWDGPISVGIF 111

  Fly    83 AAGPEEF---VVLQYFVTYMRLCFANIRENATFHL-LTPRDFDK-LPRVAALPLNMRGKFDCQYP 142
            .    :|   ..|:|.....| |....|:..|.|. :....|.: .|::             |.|
 Worm   112 I----DFHSSQALEYLAEVHR-CDEEFRKKMTIHFAIRQSAFQQTCPKI-------------QIP 158

  Fly   143 --DRTLKALLKFRS----LKTLQWRQRNTYPQNHMRNLARKGCQTKYVFLTDIDIVPSTNSVPQL 201
              |||   ..|||:    |::........||.|.||||||:|.::...|:.|.|::.|.....:|
 Worm   159 ASDRT---CWKFRADQSYLRSHLSGPFQLYPSNLMRNLARQGAKSDIHFIMDADMIVSEGFARKL 220

  Fly   202 NHFFRTAN------CTKSCAYVIPTFEIDVRATF-PRSKNALVRLIRKGLARPFHEKVFIYNQYA 259
            .   :.||      ..|..|  |..|| .|..|: ||:...|.:.:.......||.:.|....:.
 Worm   221 K---KVANEMIDGKSKKVLA--IRRFE-SVNGTYLPRTHFELKQSMAYSKTFEFHHRFFPQGHHI 279

  Fly   260 TNFSKWLSPNTNETEVSVSHV-VTNFEFLYEPFYIAVDNAPAHDERFLGYGFTRNSQVYEMHIAG 323
            .:..:|...:...|.||...: ...:|  :|...|...|.|.:...|.......:|.:|.:..||
 Worm   280 EHLEQWFEVSKQSTSVSTMEIPFAGYE--WEVQVILHRNDPYNAAYFPSRIKVMHSLIYALCRAG 342

  Fly   324 YQFYVLSPVFTGHWGLQ 340
            |.|:|.|.||..|.|::
 Worm   343 YTFHVPSHVFDVHEGIK 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3253NP_001246488.1 Glyco_transf_49 52..371 CDD:290607 79/308 (26%)
bgnt-1.2NP_001300086.1 Glyco_transf_49 80..393 CDD:290607 79/309 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I6018
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I3878
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49245
OrthoDB 1 1.010 - - D485184at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14638
orthoMCL 1 0.900 - - OOG6_105249
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4907
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.