DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3253 and bgnt-1.3

DIOPT Version :9

Sequence 1:NP_001246488.1 Gene:CG3253 / 37861 FlyBaseID:FBgn0041706 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_507102.1 Gene:bgnt-1.3 / 184798 WormBaseID:WBGene00009032 Length:417 Species:Caenorhabditis elegans


Alignment Length:305 Identity:79/305 - (25%)
Similarity:121/305 - (39%) Gaps:42/305 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VCLATQTSVERLNSLPQVAANWQGKMSVALFAAGPEEFVVLQYFVTYMRLCFANIRENATFHLLT 116
            |.|||..:.:.:.::..:...|.|.:|:.:| .....:.||:|.....| |..:.|.....|.. 
 Worm    92 VTLATHATADMIETVENMTFLWDGPISIGIF-VDYHSYNVLEYLAEVHR-CDVSFRRKMNVHFA- 153

  Fly   117 PRDFDKLPRVAALPLNMRGKFDCQYPDRTLKALLKFRSLKTLQWRQRNT-------YPQNHMRNL 174
               |.:.|.....||       .:.| ::.::..:|.:..|   ..||.       ||.|.|||:
 Worm   154 ---FRRSPFQTECPL-------IEIP-QSNRSCQEFFATHT---ELRNAIVGPFQLYPSNLMRNI 204

  Fly   175 ARKGCQTKYVFLTDIDIVPSTNSVPQLNHFFRTAN----CTKSCAYVIPTFEIDVRATFPRSKNA 235
            ||||.||...|:.|.|:|||.....::.   |.||    ........|..||....|..||....
 Worm   205 ARKGAQTDLQFIMDGDMVPSEGFATKIK---RIANEVIDGKNKRVLAIRRFETSDTAEIPRDHLK 266

  Fly   236 LVRLIRKGLARPFHEKVFIYNQYATNFSKWLSPNTNETEVSVSHVVTNFE-----FLYEPFYIAV 295
            |::..:......||.:.|....:......|...:.:      |.|||..|     :|:|...|..
 Worm   267 LLKSKKLHKTFEFHHRYFPEGHHIDGLDDWFRTSIH------SGVVTTKEVAYPGYLWEVQTILH 325

  Fly   296 DNAPAHDERFLGYGFTRNSQVYEMHIAGYQFYVLSPVFTGHWGLQ 340
            .|.|.:.:.|.......:|.||.:..|||.|:|.:.||..|.|::
 Worm   326 RNDPYNADYFPSRIKVMHSLVYALCRAGYTFHVPTHVFDSHRGIK 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3253NP_001246488.1 Glyco_transf_49 52..371 CDD:290607 79/305 (26%)
bgnt-1.3NP_507102.1 Glyco_transf_49 91..404 CDD:290607 79/305 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I6018
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I3878
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49245
OrthoDB 1 1.010 - - D485184at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14638
orthoMCL 1 0.900 - - OOG6_105249
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4907
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.