DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3253 and B4gat1

DIOPT Version :9

Sequence 1:NP_001246488.1 Gene:CG3253 / 37861 FlyBaseID:FBgn0041706 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_780592.1 Gene:B4gat1 / 108902 MGIID:1919680 Length:415 Species:Mus musculus


Alignment Length:350 Identity:111/350 - (31%)
Similarity:155/350 - (44%) Gaps:58/350 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VCLATQTSVERLNSLPQVAANWQGKMSVALFAAGPEE---FVVLQYFVTYMRLCFANIRENATFH 113
            |.|||..||:.|..|..:...|:|.:||::|||..||   ..||.|.::  ..| ..:|.....|
Mouse    95 VILATHASVDNLLHLSGLLERWEGPLSVSVFAATKEEAQLATVLAYALS--SHC-PEMRARVAMH 156

  Fly   114 LL----------TPRD-------------FDKLPRVAALPLNMRGKFDCQYPDRTLKALLKFRSL 155
            |:          .||:             ||||.|||...:|.                    :|
Mouse   157 LVCPSRYEAAVPDPREPGEFALLRSCQEVFDKLARVAQPGINY--------------------AL 201

  Fly   156 KTLQWRQRNTYPQNHMRNLARKGCQTKYVFLTDIDIVPSTNSVPQLNHFFRTANCTKSCAYVIPT 220
            .|     ..:||.|.:|||||:  :..|..:.|:|:|||......|......:|.....|.|:|.
Mouse   202 GT-----NTSYPNNLLRNLARE--EANYALVIDVDMVPSEGLWRGLREMLDQSNHWDGTALVVPA 259

  Fly   221 FEIDVRATFPRSKNALVRLIRKGLARPFHEKVFIYNQYATNFSKWLSPNTNETEVSVSHVVTNFE 285
            |||......|.:||.||:|.:.|..|||:..:.......||:|:|:  |..|..:.....|..:.
Mouse   260 FEIRRSRRMPMNKNELVQLYQVGEVRPFYYGLCTPCHAPTNYSRWV--NLPEESLLRPAYVVPWR 322

  Fly   286 FLYEPFYIAVDNAPAHDERFLGYGFTRNSQVYEMHIAGYQFYVLSPVFTGHWGLQRKQARPAWRE 350
            ..:||||:|....|..||||..|||.|.||..|:|:||:.|.||:..|..|.|.:........:|
Mouse   323 DPWEPFYVAGGKVPTFDERFRQYGFNRISQACELHVAGFNFEVLNEGFLVHKGFKEALKFHPQKE 387

  Fly   351 QQNNANRRKFDVFKSEIFVRYKNDP 375
            .:|..|:..:..||.|:..||.|.|
Mouse   388 AENQRNKILYRQFKQELKARYPNSP 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3253NP_001246488.1 Glyco_transf_49 52..371 CDD:290607 107/344 (31%)
B4gat1NP_780592.1 Glyco_transf_49 94..408 CDD:290607 107/344 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 140 1.000 Domainoid score I4757
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H38239
Inparanoid 1 1.050 144 1.000 Inparanoid score I4432
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49245
OrthoDB 1 1.010 - - D729091at2759
OrthoFinder 1 1.000 - - FOG0003642
OrthoInspector 1 1.000 - - oto93723
orthoMCL 1 0.900 - - OOG6_105249
Panther 1 1.100 - - LDO PTHR46420
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5095
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.