DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3253 and large1

DIOPT Version :9

Sequence 1:NP_001246488.1 Gene:CG3253 / 37861 FlyBaseID:FBgn0041706 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_031754415.1 Gene:large1 / 100498555 XenbaseID:XB-GENE-6250446 Length:754 Species:Xenopus tropicalis


Alignment Length:420 Identity:94/420 - (22%)
Similarity:158/420 - (37%) Gaps:132/420 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FDNINLSYGRWDNQLL---------------------------------YRIKDFAL-------L 39
            |.|:.|::..:|..||                                 :|.:.|.:       |
 Frog   395 FRNLYLTFLEYDGNLLRRELFGCPSEADVNSENLQKQLSELDEDDLCYEFRRERFTVHRTHLYFL 459

  Fly    40 GEQYVDSSEGSLVCLATQTSVERLNSLPQVAANWQGKMSVALFAAGPEEFVVLQYFVTYMRLCFA 104
            ..:|..:.:.:.|.|..|.|::||..|..:..:|:|.:|:||:.:..|    .|.|:.|.:....
 Frog   460 HYEYKPAGDDTDVTLVAQLSMDRLQMLEAICKHWEGPISLALYLSDAE----AQQFLRYAQGSEV 520

  Fly   105 NI-RENATFHLLTPRDFDKLPRVAALPLNMRGKFDCQYPDRTLKALLKFRSLKTLQWRQRNTYPQ 168
            .: |.|..:|::                                            :::...||.
 Frog   521 LLNRRNVGYHIV--------------------------------------------YKEGQFYPV 541

  Fly   169 NHMRNLARKGCQTKYVFLTDIDIVPS-------TNSVPQLNHFFRTANCTKSCAYVIPTFE-IDV 225
            |.:||:|.|...|.|:||:|||.:|.       ..:|.||:     ...||. |.:||.|| :..
 Frog   542 NLLRNVAMKHVSTPYMFLSDIDFLPMYGLYESLRKAVVQLD-----MKITKK-ALIIPAFETLRY 600

  Fly   226 RATFPRSKNALVRLIRKGLARPFHEKVFIYNQYATNFSKWLSPNTNETEVSVSHVVTNFEFLYEP 290
            |.:||:||..|:.::..|....|...|:......|||:||   .|..|...|     .:|..:||
 Frog   601 RLSFPKSKAELLSMLDMGTLFTFRYHVWTKGHGPTNFAKW---RTATTPYRV-----EWEADFEP 657

  Fly   291 FYIAVDNAPAHDERFLGYGFTRNSQVYEMHIAGYQFYVLSPVFTGHWGLQRKQARPAWREQQNNA 355
            :.:...:.|.:|.||:|:|:.:.:.:.|:....|:|.||...:..|.                 .
 Frog   658 YVVVRRDCPEYDRRFVGFGWNKVAHIMELDAQEYEFTVLPNAYMIHM-----------------P 705

  Fly   356 NRRKFDVFKSEIFVRYKNDPRLLLKAKKNQ 385
            :...||:.|    .|.....|:.||..|.:
 Frog   706 HAPSFDITK----FRSNKQYRVCLKTLKEE 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3253NP_001246488.1 Glyco_transf_49 52..371 CDD:290607 79/327 (24%)
large1XP_031754415.1 GT8_LARGE_C 136..415 CDD:133053 6/19 (32%)
Glyco_transf_49 471..740 CDD:404735 84/344 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D729091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.