DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3253 and gxylt1a

DIOPT Version :9

Sequence 1:NP_001246488.1 Gene:CG3253 / 37861 FlyBaseID:FBgn0041706 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_017209692.1 Gene:gxylt1a / 100333154 ZFINID:ZDB-GENE-110314-1 Length:342 Species:Danio rerio


Alignment Length:325 Identity:65/325 - (20%)
Similarity:110/325 - (33%) Gaps:87/325 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 MSVALFAAGPEEFVVLQYFVTYMRLCFANIRENATFHLLTPRDF-----DKLPRVAALPLNMRGK 136
            :.:|:.|.|..    ||..:|.::......|....||:....|.     |.|   .:.|..:|.:
Zfish    15 VQLAVVACGSR----LQETLTMIKSAVIFSRSELHFHIFAEEDLHAGFRDTL---QSWPQRVRSR 72

  Fly   137 FDCQ-YPDRTLKALLKFRSLKTLQWRQRNTYPQNHMRNLARKGCQTKYVFL------------TD 188
            |... ||       :.|.|....:||:            ..|.|.::.:||            .|
Zfish    73 FSYSIYP-------ISFPSENAREWRK------------LFKPCASQRLFLPLILKQVDSVLYVD 118

  Fly   189 IDIV---PSTNSVPQLNHFFRTANCTKSCAYVIPTFEIDVRATFPR----------SKNALVRLI 240
            .||:   |..:....|:.|.|:     ..|.:.|..|......:.|          ..|:.|.||
Zfish   119 TDILFLRPVEDIWSFLSSFNRS-----HVAALAPEHEEPRMGWYNRFARHPYYGKTGVNSGVMLI 178

  Fly   241 RKGLARPFHEKVFIYNQYATNFSKW---LSPNTNETEVSVS---HVVTNFEFLYEPFYIAVDNAP 299
            .....|..|.|    |..:.....|   |.|..|:.:::::   ..:.|..|.|.|..:.|  .|
Zfish   179 NMTRIRHTHFK----NDLSAMDLSWSDLLMPLLNKYKLNITWGDQDLLNIIFHYNPESLLV--FP 237

  Fly   300 AHDERFLGYGFTRNSQVYEMHIAG---YQFYVLSPVFTGHWGLQRKQARPAWREQQNNANRRKFD 361
            .|      :.:..:..:|..:.|.   :..|:|.    |:.|:.....:||:....|...:..|:
Zfish   238 CH------WNYRPDHCIYGSNCAAAEQHGIYILH----GNRGVYHDDKQPAFSAVYNAIQQYAFE 292

  Fly   362  361
            Zfish   293  292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3253NP_001246488.1 Glyco_transf_49 52..371 CDD:290607 65/325 (20%)
gxylt1aXP_017209692.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.