DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3253 and large2

DIOPT Version :9

Sequence 1:NP_001246488.1 Gene:CG3253 / 37861 FlyBaseID:FBgn0041706 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001096468.1 Gene:large2 / 100125087 XenbaseID:XB-GENE-5871953 Length:723 Species:Xenopus tropicalis


Alignment Length:337 Identity:81/337 - (24%)
Similarity:132/337 - (39%) Gaps:80/337 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VCLATQTSVERLNSLPQVAANWQGKMSVALFAAGPEEFVVLQYFVTYMRLC-FANIRENATFHLL 115
            |.|..|.|::||..|..:..:|.|.||:||:.:..|    .|.|:.|.:.. ....|.|..:|::
 Frog   441 VTLVAQLSMDRLQMLELICRHWDGPMSLALYLSDAE----AQQFLRYAQASEVLQSRTNVAYHVV 501

  Fly   116 TPRDFDKLPRVAALPLNMRGKFDCQYPDRTLKALLKFRSLKTLQWRQRNTYPQNHMRNLARKGCQ 180
                                                        :::...||.|.:||:|.|..|
 Frog   502 --------------------------------------------YKEGQLYPVNLLRNVALKNSQ 522

  Fly   181 TKYVFLTDIDIVPSTNSVPQLNHFFRTANCT-KSCAYVIPTFE-IDVRATFPRSKNALVRLIRKG 243
            |.||||:|||.:|.......|.......:.| ...|.::|.|| :..|.:||:||..|:.::..|
 Frog   523 TPYVFLSDIDFLPMYGLYEYLRKSISQQDLTGPPKALIVPAFETLRYRLSFPKSKAELLSMLDTG 587

  Fly   244 LARPFHEKVFIYNQYATNFSKWLSPNTNETEVSVSHVVTNFEFLYEPFYIAVDNAPAHDERFLGY 308
            ....|...|:......|:::||   .|..|...|.....     :||:.:...:.|.:|:||||:
 Frog   588 ALYTFRYHVWEKGHAPTDYAKW---RTATTPYRVEWAPD-----FEPYVVVRRDCPEYDQRFLGF 644

  Fly   309 GFTRNSQVYEMHIAGYQFYVLSPVFTGHWGLQRKQARPAWREQQNNANRRKFDVFKSEIFVRYKN 373
            |:.:.|.:.|:....::..||...|..|.                 .:...||:.|    .|...
 Frog   645 GWNKVSHIMELDAQEHELLVLPNAFIIHM-----------------PHAPSFDISK----FRSSE 688

  Fly   374 DPRLLLKAKKNQ 385
            :.||.::|.|.:
 Frog   689 NYRLCVQALKEE 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3253NP_001246488.1 Glyco_transf_49 52..371 CDD:290607 76/321 (24%)
large2NP_001096468.1 GT8_LARGE_C 107..386 CDD:133053
Glyco_transf_49 440..709 CDD:290607 81/337 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D729091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.