DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment enok and SAMD1

DIOPT Version :9

Sequence 1:NP_001286823.1 Gene:enok / 37859 FlyBaseID:FBgn0034975 Length:2291 Species:Drosophila melanogaster
Sequence 2:NP_612361.1 Gene:SAMD1 / 90378 HGNCID:17958 Length:538 Species:Homo sapiens


Alignment Length:64 Identity:23/64 - (35%)
Similarity:39/64 - (60%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WNQWILEAISKIRSQKQRPSVQRICQAIGTHHKFHEDIVAEKLEKAVESGAVIKVYNKGLHSYK 77
            :.:|||:.|..:||:|.||.::|||:.:...|....:....:|||.::..||::|..||..||:
Human    31 YQEWILDTIDSLRSRKARPDLERICRMVRRRHGPEPERTRAELEKLIQQRAVLRVSYKGSISYR 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enokNP_001286823.1 H15 95..152 CDD:294056
PHD_SF 183..>215 CDD:304600
PHD 248..292 CDD:214584
NAT_SF 713..989 CDD:302625
MOZ_SAS 768..947 CDD:280097
Ehrlichia_rpt <1150..>1539 CDD:118064
SAMD1NP_612361.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..247 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..458
SAM_Atherin-like 459..527 CDD:188982
SAM 459..525 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.